Food Everything+ Add
← All recipes

Rich Fruitcake

familynewspaper-clippingdessertfruitcakeneeds review
Cook: 1 1/2 hours
Rich Fruitcake

Ingredients

You have 3 of 9
produce
  • ○2 poundspitted dates
  • ○2 poundscherries(mixed red and green)
protein
  • ○4eggs(large)
  • ○1 poundpecans(halves and pieces)
  • ○1/2 poundswalnuts(halves and pieces)
grain
  • ✓2 1/2 cupsflour
pantry staple
  • ○1 teaspoonvanilla
  • ✓1/4 cupsugar
  • ✓1 teaspoonbaking powder
  • ·1/4 teaspoonsalt

Instructions

  1. Mix fruit and nuts.
  2. Sprinkle with combined sifted flour, sugar, baking powder and salt.
  3. Add eggs and vanilla and mix.
  4. Grease two loaf pans and line with brown paper.
  5. Pour batter into pans.
  6. Bake in slow oven on 300 degrees F for 1 1/2 hours.

My notes

2019 - best follow Rich Fruitcake amnts decreased fruits & nuts & added raisins 2 cups flour 1/2 cup sugar 1 1/2 tsp baking powder 5 large eggs Handwritten notes on original recipe: - "piece" crossed out and replaced with "no candied fruit mix 8-03" - An arrow points to "candied fruit" with "at top" note - "2 cups P flour" alongside "1/2 cup sugar" - "5 large eggs" at the end of modifications - "decreased soaked time" - "temp lower slowly curver ged as lower MP"